Part Number Hot Search : 
SXXXJ LS356 54732 LTC3855 4HC04 LTV8192M 10XB60 PLCC4
Product Description
Full Text Search
 

To Download TM057KVHG01 Datasheet File

  If you can't view the Datasheet, Please click here to try to view without PDF Reader .  
 
 


  Datasheet File OCR Text:
  TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 specification tft lcd module preliminaryspecification finalspecification --------------------------------------------------- --------------------------------------------------- --------------------------- tianma micro-electronics co., ltd address: 8f 64th building jinlong majialong industrial area, nanshan district, shenzh en, china tel: +86-755-26094288 fax: +86-755-86225774 web: www.tianma.cn www.tianma.com --------------------------------------------------- --------------------------------------------------- -------------------------- model no: TM057KVHG01 customer: customer p/n. version v0.1 customer approved preparedby checkedby verifiedby qadept. approvedby
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 revision record version page revisionitems name date 0.1 firstrelease jim 2013.03.21
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 table of contents 1.generalspecifications......................... ................................................... ....................................3 2. input/outputterminals........................ ................................................... ..................................5 2.1tftlcdpinassignment......................... ................................................... ........................5 2.2backlightpinassignment................... ................................................... ................................6 2.3ctppinassignment......................... ................................................... .................................6 3.absolutemaximumratings........................ ................................................... ..............................6 4.electricalcharacteristics..................... ................................................... .....................................7 41drivingtftlcd................................ ................................................... ..............................7 4.2drivingctp................................... ................................................... ..................................7 4.3drivingbacklight............................. ................................................... ................................8 5.blockdiagram...........t...................... ................................................... ........................................9 6.tfttimingchart............................... ................................................... ....................................10 7.ctptiming..................................... ................................................... .......................................14 8.opticalcharacteristics........................ ................................................... ...................................15 9.reliabilitytest............................... ................................................... .........................................18 10.mechanicaldrawing............................ ................................................... .................................20 11.productinspectioncriteria.................... ................................................... ................................21 12.precautionsforuseoflcdmodules............. ................................................... .......................26 13.packing........................................ ................................................... .........................................28 14.productpartnumbersystem..................... ................................................... ............................29
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 4 4 1generalspecifications TM057KVHG01isacoloractivematrixlcdmoduleinc orporatingamorphoussilicontft (thinfilmtransistor).itiscomposedofacolort ftlcdpanel,driveric,fpc,abacklight unitandctp(capacitivetouchpanel)withmultito uchfunction.themountingmethodis withtapebonding.thisproductaccordswithrohs environmentalcriterion. item feature spec unit note tft lcd module size 5.7 inch lcdresolution 320(rgb)x240 interface tftlcd:rgb18bits ctp:i2c colordepth 262k lcdtechnologytype asitft pixelpitch 0.360x0.360 mm pixelconfiguration r.g.b.verticalstripe lcddisplaymode tmwithnormallywhite surfacetreatment ctp:6hhardness lcduppolarizer:ag(3h) viewingdirection 6oclock grayscaleinversiondirection 12oclock activearea tftlcd: 144.00(w)x104.60(h) mm ctp:119.20(w)x90.40(h) mm lcm(wxhxd) 144.00x104.60x12.30 mm controlic ctp: nt11003 tftlcd:nt39413 ctptouchmethod barefinger numberofsimultaneoustouches 2points minimumtoucharea 6 mm fingertouchpitch 15 mm ctpstructure glasslens glasssensor lednumbers 15leds pcs weight tbd g
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 5 5 2. input/output terminals 2.1 tft lcd pin assignment 2.2 backlight pin assignment
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 6 6 2.3 ctp pin assignment pin no. symbol i/o description remark 1 gnd p groud 2 reset i/o externalinterruptfromthehost 3 vdd p ctppowersupply 4 int i/o externalinterrupttothehost 5 scl i/o i2cclockinput 6 sda i/o i2cdatainputandoutput 7 h_sync i/o externalsingalfromlcd 8~10 nc nc nc note:i/odefinition. iinput,ooutput,ppower/ground,n noconnection 3. absolute maximum ratings ta=25 item symbol m in m ax unit remark powervoltage vcc(lcd) 0.3 5 v vdd(ctp) 0.3 3.6 v an1,an2,an3 (backlight) 0 25.9 v operatingtemperature topr 20 70 storagetemperature tstg 30 80 note1 table 3.1 absolute maximum rating note1:80 isthesurfacetemperatureofmodule
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 7 7 electrical characteristics 4.1 .1 driving tft lcd ta=25 item symbol m in t yp m ax unit remark voltageforlogic circuit vcc 3.0 3.30 3.60 v powersupplycurrent icc 145 225 ma input signal voltage lowlevel vil 0 0.3xvdd v r0~r5,g0~g5,b0~b5 , ck,disp,hsync, vsync,enab,r/l,u/d highlevel vih 0.7xvdd vdd v table 4.1 lcd module electrical characteristics note:totestthecurrentdissipation,useallbla ckpattern. 4.1 .2 driving ctp ta=25 item min typ max unit note powersupplyvoltage 2.7 3.3 3.6 v dc(noiseshouldbe under100mv) powersupplycurrent 6 10 ma input signal voltage lowlevel 0 0.3xvcc v int,resetp,scl,sda, hsync highlevel 0.7xvcc vcc v structure of touch lens
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 8 8 interface application 4.1.3 driving backlight table 4.1.3 led backlight characteristics note1:i f isdefined foronechannelled.therearetotalthreeledchan nelsinbacklight unit.underlcmoperating,thestableforwardcurren tshouldbeinputted. note2:opticalperformanceshouldbeevaluatedat ta=25 only. note 3:if led is driven by high current, high ambi enttemperature & humidity condition.the life timeofledwillbereduced.operatinglifemeansb rightnessgoesdownto50%initialbrightness. typicaloperatinglifetimeisestimateddata. led connection of backlight
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 9 9 5 .block diagram 5.7 inch 320(rgb)*240 tftpanel blu source+gate driver grayscale manipulation voltage vcom & tcon dc/dc fpc data bus vcc,gnd power blu an1~an3,ca1~ca3 vsync hsync r/l,u/d,ck disp r[5:0] g[5:0] b[5:0] control signalinput ctp driver:nt11003 fpc i2c interface
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 0 0 6.tft lcdtiming chart 6.1 sync mode vdd=3.3v ta=25 6.2 de mode vdd=3.3v ta=25
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 1 1 6.3 timing diagram 6.3.1 vertical input timing 6.3.2 horizontal input timing 6.4 ac input characteritics
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 2 2 6.5 power on/off sequence
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 3 3 7. ctp timing 7.1 i2c interface
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 4 4 7.2 power on sequence
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 5 5 8.optical c haracteristics item symbol condition min typ max unit remark viewangles t cr 10 R 60 70 degree note2 b 50 60 l 60 70 r 60 70 contrastratio cr =0 400 500 note1 note3 responsetime t on 25 20 30 ms note1 note4 t off chromaticity white x backlightis on 0.274 0.324 0.374 note5 note1 y 0.279 0.362 0.379 red x 0.566 0.616 0.666 y 0.303 0.353 0.403 green x 0.285 0.335 0.385 y 0.526 0.576 0.626 blue x 0.086 0.136 0.186 y 0.076 0.126 0.176 uniformity u 75 80 % note1 note6 ntsc 45 50 % luminance l 300 400 cd/m 2 note7 reflectivity 4 % note8 haze 2 % note8 testconditions: 1. i f =25ma(onechannel),theambienttemperatureis25 . 2. thetestsystemsrefertonote1andnote2. note1:definitionofopticalmeasurementsystem. theopticalcharacteristicsshouldbemeasuredind arkroom.after10minutesoperation,theoptical propertiesaremeasuredatthecenterpointofthe lcdscreen.allinputterminalslcdpanelmust begroundwhenmeasuringthecenterareaofthepan el. note2:definitionofviewinganglerangeandmeasu rementsystem. viewingangleismeasuredatthecenterpointofth elcdbyconoscope(ergo80) item photodetector field contrastratio sr3a 1 luminance chromaticity lumuniformity responsetime bm7a 2 500mm photo detector field lcd panel tft-lcd module the center of the screen
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 6 6 note3:definitionofcontrastratio whitestate:thestateisthatthelcdshoulddr ivebyvwhite. blackstate:thestateisthatthelcdshoulddri vebyvblack. vwhite:tobedetermined vblack:tobedetermined . note4:definitionofresponsetime theresponsetimeisdefinedasthelcdopticalswi tchingtimeintervalbetweenwhitestateand blackstate.risetime(t on )isthetimebetweenphotodetectoroutputintensi tychangedfrom90% to10%.andfalltime(t off )isthetimebetweenphotodetectoroutputintensi tychangedfrom10% to90%. note5:definitionofcolorchromaticity(cie1931) colorcoordinatesmeasuredatcenterpointoflcd. note6:definitionofluminanceuniformity activeareaisdividedinto9measuringareas(refe rfig.2).everymeasuringpointisplacedatthe centerofeachmeasuringarea. luminanceuniformity(u)=lmin/lmax lactivearealengthwactiveareawidth
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 7 7 lmax:themeasuredmaximumluminanceofallmeasure mentposition. lmin:themeasuredminimumluminanceofallmeasure mentposition. note7:definitionofluminance: measuretheluminanceofwhitestateatcenterpoin tonthectp note8:measuringequipments:dms501,pr705.@550n m measuringcondition: afterstabilizingandleavingthepanelaloneat agiventemperaturefor30 min, themeasurementshouldbeexecuted, measuringsurroundings:astable,windlessandda rkroom, measuringtemperature:ta=25 c, 30minafterlightingthebacklight. note2: conformtonationalstandardgb2410 80/astmd1003 61(1997)
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 8 8 9. reliability test no test item condition remarks 1 hightemperature operation ta=+70 , 120hours note1,note6,note7 iec6006821,gb2423.2 2 lowtemperature operation ta=20 , 120hours note1,note7,iec6006821 gb2423.1 3 hightemperature storage ta=+80 , 120hours note1,note7,note8 iec6006821 gb2423.2 4 lowtemperature storage ta=30 , 96hours note1,note7,ec6006821 gb2423.1 5 hightemperature& humiditystorage ta=+65 rh=90 ,120hours note1,note3,note4,note7 iec60068278 gb/t2423.3 6 thermalshock/ solderjointlifetest 30 30min ? 80 30min ,change time:5min,100cycle note1,note9 startwithcoldtemperature endwithhightemperature, iec60068214,gb2423.22 12 esd c=150pf r=330 air:8kv contact:4kv 5times (environment:15 ~35 , 30%~60%.86kpa~106kpa) note2,note5, iec6100042 gb/t17626.2 13 shocktest halfsinewave 60g ,6ms,x,y,z 3timesforeachdirection note2 14 droptest(package state) height:60cm, 1corner,3edges,6surfaces note2,iec60068232 gb/t2423.8 15 surfacehardness 6h jisk5600 16 staticload resistancetest after4.5kgloadf or1minisappliedtothe centerarea(1.0cm2)ofthetouchpanel, therequirementsinopticalcharacteristic andelectricalcharacteristicsshallbe satisfied. nocrackaftertest.
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 9 9 17 dropballtest usethe64gsteel( 25)ballisdropped ontheglasssurfacefrom70cmheightat 1time(glassside) nocrackaftertest. 18 terminalpulltest 90 o direction,weight:500g, nonoperation functionisok notes: 1.thetestresultshallbeevaluatedafterthesam plehasbeenleftatroomtemperatureand humidityfor2hourswithoutload.nocondensation shallbeaccepted.thesamplewillnotbe acceptedifappearthesedefects: 1).airbubbleinthelcd; 2).sealleak 3).nondisplay 4).missingsegments 5).glasscrack 6).crreduction>40% 7).iddincrease>100% 8).brightnessreduction>50% 9).colorcoordinatetolerance>0.05 2.thesamplesofthesetestswillnotbeaccepted ifappearthesedefects: 1).airbubbleinthelcd; 2).sealleak 3).nondisplay 4).missingsegments 5).glasscrack 3.eachtestitemappliesforatestsampleonlyon ce,thetestsamplecannotbeusedagaininany othertestitem. 4.fordampprooftest,purewater(resistance 10m)shouldbeused. 5.incaseofmalfunctiondefectcausedbyesddamag e,ifitwouldberecoveredtonormalstate afterresetting,itwouldbejudgeasagoodpart. 6inthetestofhightemperatureoperationandhig htemperature&humidityoperation,the operationtemperatureisthesurfacetemperatureof module 7 high temperature operation low temperature operation high temperature storage low temperature storage high temperature & humidity operation high temperature & humidity storagewillbeincreasedthetesttimeto1000hour sinthesameconditionstotestouttheabilityof module,andwecannotguaranteethatthemodulewi llnotfailduring1000hours.theseitemstest onlyonce 8.thermalshockwillbechangedthecycleto1000cy clestotestouttheabilityofmodule,andwe cannotguaranteethatthemodulewillnotfailaft erthetest.thisitemtestonlyonce 11
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 0 0 10. mechanical drawing
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 1 1 viewing area x1 x2 y1 y2 figure2 b zone active area(aa) azone:viewingarea(va) 11.product inspection criteria 11.1 classification of defects majordefects(ma):amajordefectreferstoadefe ctthatmaysubstantiallydegrade usabilityforproductapplications,includingallf unctionaldefects(suchasnodisplay, abnormaldisplay,openormissingsegment,shortci rcuit,missingcomponent),outline dimensionbeyondthedrawing,progressivedefectsa ndthoseaffectingreliability. minordefects(mi):aminordefectreferstoadefe ctwhichisnotconsideredtobeable tosubstantiallydegradetheproductapplicationor adefectthatdeviatesfromexisting standardsalmostunrelatedtotheeffectiveuseof theproductoritsoperation,suchas blackspot,whitespot,brightspot,pinhole,black line,whiteline,contrastvariation,glass defect,polarizerdefect,etc. 11.2 definition of inspection range fordotdefectoftftlcdwhichisnot smallerthan3inches,dividingthreeareas tomakeajudgment(accordingtofigure1). aarea:centerofviewingarea barea:peripheryofviewingarea carea:outsideviewingarea forotherdefects,dividingtwoareas tomakeajudgment(accordingfigure2). azone:insideviewingarea bzone:outsideviewingarea x1(a.a~v.a): 0 mm x2(a.a~v.a): 0 mm y1(a.a~v.a): 0 mm y2(a.a~v.a): 0 mm 11.3 inspection items and general notes general notes shouldanydefectswhicharenotspecifiedinthis standardhappen,additionalstandard shallbedeterminedbymutualagreementbetweencus tomerandtianma. viewingareashouldbetheareawhichtianmaguaran tees. limitsampleshouldbepriortothisinspectionsta ndard. viewingjudgmentshouldbeunderstaticpattern. inspectionconditions inspectiondistance:250mm(fromthesample) temperature :255oc inspectionangle :45degreesin 12 oclockdirection(alldefectsinviewingareasho uld beinspectedfromthisdirection) inspectio nitems pinhole,brightspot,blackspot, whitespot,blackline,white line,foreignparticle,bubble thecolorofasmallareaisdifferentfromthe remainder.thephenomenondoesntchangewith voltage contrastvariation thecolorofasmallareaisdifferentfromthe remainder.thephenomenonchangeswithvoltage polarizerdefect scratch,dirt,particle,bubbleonpolarizerorbet ween polarizerandglass dotdefect(tftlcd) thepixelappearsbrightordarkabnormallywhen display functionaldefect nodisplay,abnormaldisplay,openormissing segment,shortcircuit,falseviewingdirection figure1
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 2 2 b a =(a+b)/2( w: width l:length(mm ) a b =(a+b)/2(mm) glassdefect glasscrack,shavedcornerofglass,s urplusglass pcbdefect componentsassemblydefect 11.4 outgoing inspection level outgoinginspection standard inspectionconditions inspection min. max. unit il aql majordefects see9.3generalnotes see 11.5 ii 0. 65 minordefects see9.3generalnotes see 11.5 ii 1.5 note samplingstandardconformstogb2828 11.5 inspection items and criteria inspectionitems judgmentstandard category acceptablenumber azone bzone 1 blackspot, whitespot, brightspot, pinhole,foreign particle,particle inoronglass, scratchonglass a Q 0.10 neglected neglected b 0.10< Q 0.15 2 c 0.15< Q 0.20 1 d 0.20< 0 totaldefectivepoint(b,c) 3 2 blackline,white line,andparticle between polarizerand glass,scratch onglass a w Q 0.01 neglected neglected b 0.01 TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 3 3 used) darkdot 2 d total 2 b brightdot 2 darkdot 3 total 4 tftlcdbetween 3~10.4inches lcd class defect aarea barea carea a brightdot 1 1 neglecte d darkdot 1 2 total 4 b brightdot 2 2 darkdot 2 3 total 6 notes: brightdot:inr g bordarkdisplayfigure,thepixelappearsbright. darkdot:inr g borwhitedisplayfigure,thepixelappearsdark. defectareamustbelessthananhalfsizeofthed ot. 5 bubbleinsidecell anysize none none 6 polarizerdefect (ifpolarizeris used) scratch,damage onpolarizer, particleonpolarizer orbetween polarizerandglass. refertoitem1anditem2. bubble,dentand convex a Q 0.3 neglected neglecte d b 0.3< Q 0.7 2 c 0.7< 0 7 surplus glass stagesurplusglass b Q 0.3mm surrounding surplusglass shouldnotinfluenceoutlinedimensionandassembli ng. 8 opensegmentoropencommon notpermitted 9 shortcircuit notpermitted 10 falseviewingdirection notpermitted 11 contrastratiouneven accordingtothelimitspecim en 12 crosstalk accordingtothelimitspecimen 13 black/whitespot(display) refertoitem1 14 black/whiteline(display) refertoitem2 b w
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 4 4 inspectionitems judgmentstandard category(application:bzone) acceptabl enumber 15 glass defect crack thefrontofleadterminals a at, b1/5w, c3mm max.3 defects allowed b crackattwosidesoflead terminalsshouldnotcover patternsandalignmentmark surroundingcrackDnoncontact side b TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 5 5 inspectionitems judgmentstandard category(application:bzone) 16 pcb defect componentsoldering: nocoldsoldering short opencircuit burr tinball theflatencapsulationcomponent positiondeviationmustbelessthan 1/3widthofthepin(pic.1) thesheetcomponentdeviation: pindeviatesfromthepadandcontact withthenearcomponentsisnot permitted pic.2 leaddefect: theleadlackmustbelessthan1/3of itswidth; theleadburrmustbelessthan1/3of theseam; impuritiesconnectwiththenearleads isnotpermitted connectorsoldering: solderingtinisatcontactpositionof theplugandsocketisnotpermitted nofoundationisscald seriouscavedistortiononplugand socketcontactpinisnotpermitted w l w/2 component solderingpad component lead l1>0 l2>0 solderingtinisnotpermitinthis area baseboard hea d socket solderingtinisnotpermitinthis area baseboard
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 6 6 glueonrootofthespeakerreceiver andmotorlead: theinsulativecoatoftheleadmust joinintothepcb;theprotectedglue mustenveloptotheinsulativecoat. 12. precautions for use of lcd modules 12.1 handling precautions 12.1.1thedisplaypanelismadeofglass.donots ubjectittoamechanicalshockby droppingitfromahighplace,etc. 12.1.2ifthedisplaypanelisdamagedandtheliqu idcrystalsubstanceinsideitleaksout, besurenottogetanyinyourmouth,ifthesubsta ncecomesintocontactwith yourskinorclothes,promptlywashitoffusingso apandwater. 12.1.3donotapplyexcessiveforcetothedisplay surfaceortheadjoiningareassince thismaycausethecolortonetovary. 12.1.4thepolarizercoveringthedisplaysurfaceo fthelcdmoduleissoftandeasily scratched.handlethispolarizercarefully. 12.1.5ifthedisplaysurfaceiscontaminated,brea theonthesurfaceandgentlywipeit withasoftdrycloth.ifstillnotcompletelyclea r,moistenclothwithoneofthe followingsolvents: isopropylalcohol ethylalcohol solventsotherthanthosementionedabovemay damagethepolarizer. especially,donotusethefollowing: water ketone aromaticsolvents 12.1.6donotattempttodisassemblethelcdmodule . 12.1.7ifthelogiccircuitpowerisoff,donotap plytheinputsignals. 12.1.8topreventdestructionoftheelementsbyst aticelectricity,becarefultomaintain lead pcb insulativecoat glue
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 7 7 anoptimumworkenvironment. a.besuretogroundthebodywhenhandlingth elcdmodules. b.toolsrequired forassembly,suchassolderingirons,mustbeprop erlyground. c.toreducetheamountofstaticelectricity generated,donotconductassembly andotherworkunderdryconditions. d.thelcdmoduleiscoatedwithafilmtop rotectthedisplaysurface.becare whenpeelingoffthisprotectivefilmsincestatic electricitymaybegenerated. 12.2 storage precautions 10.2.1whenstoringthelcdmodules,avoidexposure todirectsunlightortothelight offluorescentlamps. 10.2.2thelcdmodulesshouldbestoredunderthes toragetemperaturerange.ifthe lcdmoduleswillbestoredforalongtime,therec ommendc onditionis: temperature: 0 40 relativelyhumidity: 80% 10.2.3thelcdmodulesshouldbestoredintheroom withoutacid,alkaliandharmful gas. 12.3 the lcd modules should be no falling and viole nt shocking during transportation, and also should avoid excessive pre ss, water, damp and sunshine.
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 8 8 13.packing drawing(reference)
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 9 9 blis te r ps,e le c tr o s ta tic p r e v e n tio n tr a y ps,e le c tr o s ta tic p r e v e n tio n tbd p c s p r o d u c ts in tbd tr a y blis te r ps,e le c tr o s ta tic p r e v e n tio n tbd fu lltr a y s +tbd e mp ty tr a y e v e r y b o x tbd p c s p r o d u c ts in 1 b o x tbd b o x e s in 1 c a s e tbd p c s in 1 c a s e packingstandards: quantityofproductstobepacka gedinacase:tbd pcs outlooksize(cartonsize):tbd c a r e ma r k caremark: pa c k a g e sig n packagesign: c a s e ma r k r e ma r k bms p.o .n o . pa r tn o . q ty c tn .n o . ttl .c tn .n o . mad ein c h in a
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 0 0 14. module part numbering system tm 057 q v z g 00 ? ? ? ? ? ? ? no. explanation tianma module indicating screen inch:043=4.3inch 057=5.7inch 070=7inch 102=1 0.2inch resolution: 480x240(delta)a 240x400(stripe)l 640x240(delta)b 400x240(stripe)m 960x240(delta)c 480x272(stripe)n 96x64(stripe) d 480x234(stripe)o 128x128(stripe)e 320x480(stripe)p 128x160(stripe)f 480x640(stripe)q 176x220(stripe)g 800x480(stripe)r 240x320(stripe)h 800x600(stripe)s 240x240(stripe)v 1024x768(stripe)t 320x320(stripe)j othersx 320x240(stripe)k
TM057KVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 1 1 product structure: tsp+bl(ccfl)+fpc+m4 a tsp+ b bl(ccfl)+fpc+m4 c bl(led)+fpc+m4 d bl(led)+fpc+m4.dualdisplay e fpc+m4 f m4 g m3 h m2 y m1 j bl(ccfl)+fpc+m4+pcb k bl(led)+fpc+m4+pcb l tsp+bl(ccfl)+fpc+m4+pcb m tsp+bl(led)+fpc+m4+pcb n ctp+bl(led)+fpc+m4 v others x m1:panel(array+cf) m2:panel(array+cf+lc) m3:panel(array+cf+lc+plz) m4:panel(array+cf+lc+plz+driver) product assembly location : shenzheng z shanghai h chengdu c wuhan w product appliction: industry:g consume:na series number: 00,01,02,03..........


▲Up To Search▲   

 
Price & Availability of TM057KVHG01

All Rights Reserved © IC-ON-LINE 2003 - 2022  

[Add Bookmark] [Contact Us] [Link exchange] [Privacy policy]
Mirror Sites :  [www.datasheet.hk]   [www.maxim4u.com]  [www.ic-on-line.cn] [www.ic-on-line.com] [www.ic-on-line.net] [www.alldatasheet.com.cn] [www.gdcy.com]  [www.gdcy.net]


 . . . . .
  We use cookies to deliver the best possible web experience and assist with our advertising efforts. By continuing to use this site, you consent to the use of cookies. For more information on cookies, please take a look at our Privacy Policy. X